PEPPI results for PPI14

log(LR) = 5.543
The chains are predicted to interact

>chain A (350 residues) [Download] MIIIRYLVRETLKSQLAILFILLLIFFCQKLVKILGAAVDGEIPTNLVLSLLGLGIPEMAQLILPL SLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKAAMILALFTGIVAAVNVMWAGPMSSRHQDEVL AEAKANPGMAALAQGQFQQATDGNSVLFIESVDGSKFNDVFLAQLRTKGNARPSVVVADSGQLAQR KDGSQVVTLNKGTRFEGTAMLRDFRITDFQNYQAIIGDPTDTEQMDMRTLWNTDTDRARAEFHWRI TLVFTVFMMALIVVPLSVVNPRQGRVLSMLPAMLLYLIYFLLQTSIRSNGAKGKLDPMVWTWFVNS LYILLALGLNLWDTVPVRRI

>chain B (355 residues) [Download] GVLDRYIGKTIFTTIMMTLFMLVSLSGIIKFVDQLKKAGQGSYDALGAGMYTLLSVPKDVQIFFPM AALLGALLGLGMLAQRSELVVMQASGFTRLQVALSVMKTAIPLVLLTMAIGEWVAPQGEQMARNYR AQAMYGGSLLSTQQGLWAKDGQNFVYIERVKGDDELGGVSIYAFNDERRLQSVRHASSAKFDPEHK QWRLSQVDESDLTNPKQITGSQTVSGTWKTNLTPDKLGVVALDPDALSISGLHNYVKYLKSSGQDA GRYQLNMWSKIFQPMSVAVMMLMALSFIFGPLRSVPMGVRVVTGISFGFVFYVLDQIFGPLTLVYG IPPIIGALLPSASFLLISLWLLLKR

Click to view SPRING scorea PDB hit BioUnitb Chainsc Query domainsd Download 51.67 6MIT 1 F;G 1;1 model1.pdb 48.429 6MJP 1 F;G 1;1 model2.pdb 48.269 5X5Y 1 F;G 1;1 model3.pdb 46.624 6MIT 1 G;F 1;1 model4.pdb 45.015 5X5Y 1 G;F 1;1 model5.pdb 44.703 6MJP 1 G;F 1;1 model6.pdb 43.089 6MIT 2 I;J 1;1 model7.pdb 39.171 6MIT 2 J;I 1;1 model8.pdb 31.58 6MI7 1 F;G 1;1 model9.pdb 30.301 6MHZ 1 F;G 1;1 model10.pdb (a) SPRING score is a scoring function consisting of a weighted sum of the threading Z-score, the model superposition TM-score and the interface energy. (b) BioUnit is the biological assembly (i.e. biounit) number. (c) Chains is the pair of chains in the PDB file that are used as the template, where the first chain corresponds to query chain A. If the two chains are the same, the template is homodimeric and is constructed of multiple copies of the same chain structure. (d) Query domains is the domain from each respective query sequence that is used in the SPRING model, where the first number corresponds to query chain A.

Total SeqID chain A (seqID) a chain B (seqID) b 100.0% springdb:6MIT01F1 (100.0%) springdb:6MIT01G1 (100.0%) 88.9% springdb:6MIT02I1 (95.1%) springdb:6MIT02J1 (83.4%) 46.6% springdb:6MJP01F1 (44.0%) springdb:6MJP01G1 (49.6%) 35.9% springdb:5X5Y01F1 (33.6%) springdb:5X5Y01G1 (38.6%) 34.9% springdb:6MHZ01F1 (34.0%) springdb:6MHZ01G1 (35.8%) 32.1% springdb:6MI701F1 (36.3%) springdb:6MI701G1 (28.7%) 11.6% springdb:5X5Y01G1 (8.3%) springdb:5X5Y01F1 (19.7%) 10.8% springdb:6MIT01G1 (12.4%) springdb:6MIT01F1 (9.6%) 10.6% springdb:6MIT02J1 (12.3%) springdb:6MIT02I1 (9.3%) 9.4% springdb:6MJP01G1 (11.6%) springdb:6MJP01F1 (7.9%) (a) id-number of chain A in the sequence database, and the percentage sequence identity between query chain and the database hit. (b) id-number of chain B in the sequence database, and the percentage sequence identity between query chain and the database hit.

The query pair was found in STRING as 640513.Entas_3898-640513.Entas_3897

STRING feature	Score
Gene Neighborhood	0.887
Gene Fusion	0
Co-occurrence	0.342
Co-expression	0.057

CT predicted probability is 1.000

Click to view SPRING scorea PDB hit BioUnitb Chainsc Query domainsd Download 3.634 6E1H 1 B;A 1;1 modeln1.pdb 3.457 6E1H 1 A;B 1;1 modeln2.pdb 2.915 6HU9 1 a;C 1;1 modeln3.pdb 2.658 6MMH 1 A;C 1;1 modeln4.pdb 2.635 6MMH 1 C;A 1;1 modeln5.pdb 2.441 6ADQ 1 F;A 1;1 modeln6.pdb 2.012 6S7O 1 A;F 1;1 modeln7.pdb 1.756 5ABB 1 Z;B 1;1 modeln8.pdb 1.659 2AKI 1 C;Z 1;1 modeln9.pdb 1.593 2AKI 1 Z;C 1;1 modeln10.pdb (a) SPRING score is a scoring function consisting of a weighted sum of the threading Z-score, the model superposition TM-score and the interface energy. (b) BioUnit is the biological assembly (i.e. biounit) number. (c) Chains is the pair of chains in the PDB file that are used as the template, where the first chain corresponds to query chain A. If the two chains are the same, the template is homodimeric and is constructed of multiple copies of the same chain structure. (d) Query domains is the domain from each respective query sequence that is used in the SPRING model, where the first number corresponds to query chain A.