MetaGO result for job id PF16199

User Input

>UniRef100_A0A0P5ED75/20-334 (315 residues)
SDIIQELLKAHENGKDLNLNKIKTQISSKYGLPSTPKLVDIIAAVPIEHRKILVPKLKAK
PIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIR
ARYNPYLQTRQRVEQLKQLGHSVDKVEFIVMGGTFMSLPEDYRDYFIRNLHDALSGHTSN
DVTQAVEYSERSLTKCIGITIETRPDYCLKRHQSDMLKYGCTRLEIGVQSVYEDIARDTN
RGHTVKAVCESFHLGKDSGFKIVSHMMPDLPNVGLERDIDQFIEFFENPLFRADGLKIYP
TLVIRGTGLYELWKT

Download query sequence and structure

Proteins with similar structure

Spin On/Off

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6fd2B	0.54	5.15	0.119	0.771	Download
2	4jc0A	0.54	4.81	0.094	0.743	Download
3	1oltA1	0.52	4.64	0.096	0.708	Download
4	5ul2A	0.51	5.41	0.084	0.762	Download
5	3hz3A3	0.50	5.88	0.050	0.778	Download
6	4ha3A	0.50	5.87	0.038	0.771	Download
7	6hvgA	0.50	6.07	0.042	0.784	Download
8	5lfcA1	0.49	5.98	0.080	0.771	Download
9	1gowA	0.49	5.86	0.030	0.759	Download
10	1qvbA	0.49	5.65	0.060	0.752	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003824	0.97	catalytic activity
GO:0016740	0.96	transferase activity
GO:0016407	0.48	acetyltransferase activity
GO:0004402	0.46	histone acetyltransferase activity
GO:0003676	0.17	nucleic acid binding
GO:0003677	0.07	DNA binding
GO:0043169	0.03	cation binding
GO:0044877	0.02	macromolecular complex binding
GO:0016758	0.02	transferase activity, transferring hexosyl groups
GO:0070577	0.01	lysine-acetylated histone binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	1.00	cellular process
GO:0044260	0.97	cellular macromolecule metabolic process
GO:0044238	0.97	primary metabolic process
GO:0065007	0.90	biological regulation
GO:0050789	0.90	regulation of biological process
GO:0050794	0.87	regulation of cellular process
GO:0019222	0.83	regulation of metabolic process
GO:0060255	0.82	regulation of macromolecule metabolic process
GO:0010468	0.81	regulation of gene expression
GO:0031323	0.79	regulation of cellular metabolic process
GO:0080090	0.78	regulation of primary metabolic process
GO:0051252	0.77	regulation of RNA metabolic process
GO:0009889	0.77	regulation of biosynthetic process
GO:0006355	0.76	regulation of transcription, DNA-templated
GO:1901360	0.62	organic cyclic compound metabolic process
GO:0046483	0.62	heterocycle metabolic process
GO:0034641	0.62	cellular nitrogen compound metabolic process
GO:0006725	0.62	cellular aromatic compound metabolic process
GO:0006139	0.61	nucleobase-containing compound metabolic process
GO:0090304	0.60	nucleic acid metabolic process
GO:0044249	0.59	cellular biosynthetic process
GO:0009059	0.59	macromolecule biosynthetic process
GO:0043412	0.57	macromolecule modification
GO:0016070	0.48	RNA metabolic process
GO:0044699	0.39	single-organism process
GO:0006357	0.36	regulation of transcription from RNA polymerase II promoter
GO:0006396	0.27	RNA processing
GO:0016043	0.26	cellular component organization
GO:0044763	0.25	single-organism cellular process
GO:0034654	0.24	nucleobase-containing compound biosynthetic process
GO:0034660	0.23	ncRNA metabolic process
GO:0032774	0.23	RNA biosynthetic process
GO:0034470	0.20	ncRNA processing
GO:0043933	0.19	macromolecular complex subunit organization
GO:0006325	0.17	chromatin organization
GO:0009451	0.15	RNA modification
GO:0006399	0.15	tRNA metabolic process
GO:0006400	0.14	tRNA modification
GO:0006354	0.14	DNA-templated transcription, elongation
GO:0006368	0.13	transcription elongation from RNA polymerase II promoter
GO:0002098	0.13	tRNA wobble uridine modification

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044424	1.00	intracellular part
GO:0032991	1.00	macromolecular complex
GO:0044428	0.99	nuclear part
GO:0043234	0.94	protein complex
GO:0005634	0.77	nucleus
GO:0005737	0.63	cytoplasm
GO:0044451	0.60	nucleoplasm part
GO:1902494	0.57	catalytic complex
GO:1990234	0.45	transferase complex
GO:0044427	0.43	chromosomal part

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]