Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threading program | | 20 40
| | |
| Seq | HCPLCQHAAHARTSRYITDTTKERYHQCQNVNCSATFITYESVQRYI |
1 | 5iy6U2 | 0.13 | 0.11 | 3.68 | 1.74 | SPARKS-K | | TCGKCKKKTYTQVQTRSADEPMTTFVVCNE--CGNRWKFC------- |
2 | 1qypA | 0.23 | 0.19 | 6.00 | 1.10 | MUSTER | | TCPKCGNDTAYWWEMQTGDEPSTIFYKCTK--CGHTWRSYE------ |
3 | 1qypA | 0.23 | 0.19 | 6.00 | 1.63 | Neff-PPAS | | TCPKCGNDTAYWWEMQTGDEPSTIFYKCTK--CGHTWRSYE------ |
4 | 5flmI | 0.15 | 0.13 | 4.28 | 1.49 | HHsearch | | PCQKCGHKEVFQSHSARAEDAMRLYYVCTAPHCGHRWTE-------- |
5 | 1tfiA | 0.13 | 0.11 | 3.68 | 1.71 | SPARKS-K | | TCGKCKKKTYTQVQTRSADEPMTTFVVCNE--CGNRWKFC------- |
6 | 2nvyI2 | 0.25 | 0.19 | 5.94 | 0.53 | FFAS-3D | | ECPKCHSREFFQSQQRRKDTSMVLFFVCLS--CSHIFT--------- |
7 | 4c2mI | 0.21 | 0.17 | 5.43 | 0.74 | HHpred | | KCPQCGNEEYHTLQLRSADEGATVFYTCT--SCGYKFRTNN------ |
8 | 1tfiA | 0.13 | 0.11 | 3.68 | 1.00 | MUSTER | | TCGKCKKKTYTQVQTRSADEPMTTFVVCNE--CGNRWKFC------- |
9 | 5iy6I | 0.15 | 0.13 | 4.28 | 0.87 | CNFpred | | PCQKCGHKEAVFFQSHRAEDAMRLYYVCTAPHCGHRWTE-------- |
10 | 5flmI | 0.15 | 0.13 | 4.28 | 0.92 | HHsearch-2 | | PCQKCGHKEFFQSHSARAEDAMRLYYVCTAPHCGHRWTE-------- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|